Antibodies

View as table Download

Rabbit Polyclonal NKX2-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NKX2-2 antibody was raised against a 19 amino acid synthetic peptide near the center of human NKX2-2.

Rabbit Polyclonal Anti-NKX2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX2-2 antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ

Nkx2.2 (NKX2-2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 98-128aa) of human NKX2-2

Rabbit Polyclonal Anti-NKX2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NKX2-2 antibody is: synthetic peptide directed towards the N-terminal region of Human NKX2-2. Synthetic peptide located within the following region: GLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKA

Rabbit Polyclonal Anti-NKX2-2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NKX2-2 Antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ

Rabbit Polyclonal Anti-NKX2-2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX2-2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS