Nkx2.2 (NKX2-2) Rabbit Polyclonal Antibody
Other products for "NKX2-2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NKX2-2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 30 kDa |
Gene Name | NK2 homeobox 2 |
Database Link | |
Background | Nkx2-2 contains 1 homeobox DNA-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. |
Synonyms | NKX2.2; NKX2B |
Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.