Nkx2.2 (NKX2-2) Rabbit Polyclonal Antibody

CAT#: TA342285

Rabbit Polyclonal Anti-NKX2-2 Antibody

Product Images

WB Suggested Anti-NKX2-2 Antibody Titration: 0.125 ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NKX2-2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: NK2 homeobox 2
• Database Link:
  NP_002500
  Entrez Gene 18088 Mouse
  UniProt ID O95096
• Background: Nkx2-2 contains 1 homeobox DNA-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance.
• Synonyms: NKX2.2; NKX2B
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young