Rabbit Polyclonal Anti-TEAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the C terminal of human TEAD1. Synthetic peptide located within the following region: YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK |
Rabbit polyclonal anti-TEAD1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TEAD1. |
Rabbit Polyclonal anti-TEAD1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the middle region of human TEAD1. Synthetic peptide located within the following region: PASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGH |
Rabbit Polyclonal Anti-TEAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the N terminal of human TEAD1. Synthetic peptide located within the following region: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY |
Germany
Japan
United Kingdom
China
