USD 450.00
2 Weeks
Asialoglycoprotein Receptor 1 (ASGR1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ASGR1 |
Rabbit Polyclonal Anti-ASGR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASGR1 antibody: synthetic peptide directed towards the N terminal of human ASGR1. Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS |
Rabbit Polyclonal Anti-ASGR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASGR1 antibody is: synthetic peptide directed towards the middle region of Human ASGR1. Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS |
Rabbit Polyclonal Anti-ASGR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASGR1 |
Germany
Japan
United Kingdom
China
