Antibodies

Jump to Filters
View as table Download
CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody
TA342812

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNTFR Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTFR antibody: synthetic peptide directed towards the C terminal of human CNTFR. Synthetic peptide located within the following region: VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG
CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody
TA324163

USD 345.00

4 Weeks

Anti-CNTFR Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-342 amino acids of human ciliary neurotrophic factor receptor
CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody
TA324164

USD 345.00

4 Weeks

Anti-CNTFR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-342 amino acids of human ciliary neurotrophic factor receptor