Rabbit Polyclonal anti-ISL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ISL1 antibody is: synthetic peptide directed towards the C-terminal region of Human ISL1. Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP |
Rabbit Polyclonal Anti-ISL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISL1 antibody: synthetic peptide directed towards the N terminal of human ISL1. Synthetic peptide located within the following region: IECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPLSPLH |
Islet1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-349 of human Islet1 (NP_002193.2). |
| Modifications | Unmodified |
Islet 1 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Islet 1 |
Islet 1 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Islet1 |
Islet 1 Rabbit polyclonal Antibody
| Applications | FC, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human Islet 1 |
Germany
Japan
United Kingdom
China