Islet 1 (ISL1) Rabbit Polyclonal Antibody

CAT#: TA329238

Rabbit Polyclonal anti-ISL1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ISL1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ISL1 antibody is: synthetic peptide directed towards the C-terminal region of Human ISL1. Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name ISL LIM homeobox 1
Background ISL1 is a member of the LIM/homeodomain family of transcription factors. It binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. ISL1 is central to the development of pancreatic cell lineages and may also be required for motor neuron generation.
Synonyms Isl-1; ISLET1
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families ES Cell Differentiation/IPS, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.