Islet 1 (ISL1) Rabbit Polyclonal Antibody

CAT#: TA329238

Rabbit Polyclonal anti-ISL1 Antibody

Product Images

Host: Rabbit; Target Name: ISL1; Sample Tissue: Breast Tumor lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ISL1 antibody is: synthetic peptide directed towards the C-terminal region of Human ISL1. Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: ISL LIM homeobox 1
• Database Link:
  NP_002193
  Entrez Gene 3670 Human
  UniProt ID P61371
• Background: ISL1 is a member of the LIM/homeodomain family of transcription factors. It binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. ISL1 is central to the development of pancreatic cell lineages and may also be required for motor neuron generation.
• Synonyms: Isl-1; ISLET1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors