Antibodies

View as table Download

Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Butyrylcholinesterase isolated and purified from Human serum.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IHC, IP, R, WB
Reactivities Human
Immunogen Butyrylcholinesterase isolated and purified from Human serum.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Butyrylcholinesterase isolated and purified from Human serum.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit anti-BCHE Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BCHE

Rabbit Polyclonal Anti-BCHE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCHE antibody: synthetic peptide directed towards the N terminal of human BCHE. Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ

BCHE rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCHE

BCHE rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCHE