Rabbit Polyclonal FKBP3 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP3 antibody: mouse FKBP3 (FK506 Binding Protein 3), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein |
Rabbit Polyclonal Anti-FKBP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP3 antibody: synthetic peptide directed towards the C terminal of human FKBP3. Synthetic peptide located within the following region: EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID |
FKBP3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FKBP3 |
FKBP3 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-224 of human FKBP3 (NP_002004.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
