Antibodies

View as table Download

Rabbit anti-HDAC3 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human HDAC3

Rabbit polyclonal HDAC3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HDAC3.

Rabbit Polyclonal Anti-HDAC3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC3 Antibody: A synthesized peptide derived from human HDAC3

Rabbit Polyclonal HDAC3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC3

Rabbit Polyclonal HDAC3 (Ser424) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC3 around the phosphorylation site of Serine 424
Modifications Phospho-specific

Rabbit Polyclonal anti-Hdac3 antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Hdac3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Anti-HDAC3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 414-428 amino acids of Human histone deacetylase 3

Anti-HDAC3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 414-428 amino acids of Human histone deacetylase 3

HDAC3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 330 to the C-terminus of human HDAC3 (NP_003874.2).
Modifications Unmodified

HDAC3 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HDAC3
Modifications Unmodified