Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MYBBP1A Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYBBP1A antibody: synthetic peptide directed towards the C terminal of mouse MYBBP1A. Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP |
Rabbit Polyclonal Anti-Mybbp1a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mybbp1a antibody: synthetic peptide directed towards the middle region of mouse Mybbp1a. Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ |
Rabbit Polyclonal Anti-MYBBP1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MYBBP1A |
MYBBP1A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1104-1328 of human MYBBP1A (NP_055335.2). |
| Modifications | Unmodified |
