Rabbit anti-SFTPC Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SFTPC |
Rabbit anti-SFTPC Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SFTPC |
Rabbit Polyclonal Anti-SFTPC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SFTPC antibody: synthetic peptide directed towards the N terminal of human SFTPC. Synthetic peptide located within the following region: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI |
SFTPC rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SFTPC |
SFTPC Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human SFTPC (NP_001165881.1). |
Modifications | Unmodified |