Antibodies

View as table Download

UBN1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBN1

UBN1 (1-190) mouse monoclonal antibody, clone UBN1-02, Aff - Purified

Applications IP, WB
Reactivities Human

Rabbit polyclonal Ubinuclein antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Ubinuclein.

Rabbit Polyclonal Anti-UBN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBN1 antibody: synthetic peptide directed towards the C terminal of human UBN1. Synthetic peptide located within the following region: NGDSSGGTQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLM

UBN1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBN1

Ubinuclein 1 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ubinuclein. AA range:161-210