FZR1 mouse monoclonal antibody, clone 4C4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
FZR1 mouse monoclonal antibody, clone 4C4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-FZR1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1. Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN |