Antibodies

View as table Download

Rabbit anti-CUL2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL2

Rabbit polyclonal anti-Cullin 2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cullin 2.

Rabbit Polyclonal Anti-Cullin 2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cullin 2 Antibody: A synthesized peptide derived from human Cullin 2

Cullin 2 (CUL2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

Rabbit polyclonal anti-Cul2 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 733-745 of Human Cul2 (C-terminus) coupled to KLH.

Rabbit Polyclonal Anti-CUL2 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUL2 antibody: synthetic peptide directed towards the middle region of human CUL2. Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA

Anti-CUL2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 214-228 amino acids of Human cullin 2