Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-SULT1A1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Goat Polyclonal Antibody against BPNT1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RNYDYYASRVPESIK, from the C Terminus of the protein sequence according to NP_006076.4. |
Rabbit Polyclonal Anti-Chst11 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Chst11 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Chst11. Synthetic peptide located within the following region: RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN |
Carrier-free (BSA/glycerol-free) SUOX mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SUOX mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PAPSS1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PAPSS1 |
SUOX mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SUOX mouse monoclonal antibody, clone OTI3C2 (formerly 3C2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SUOX mouse monoclonal antibody, clone OTI3C2 (formerly 3C2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SUOX mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SUOX mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SUOX mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SUOX mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SUOX mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8), Biotinylated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8), HRP conjugated
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks