Antibodies

View as table Download

Rabbit anti-AZGP1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AZGP1

Rabbit Polyclonal Anti-AZGP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AZGP1 antibody: synthetic peptide directed towards the N terminal of human AZGP1. Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL

Carrier-free (BSA/glycerol-free) AZGP1 mouse monoclonal antibody,clone OTI10F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AZGP1 mouse monoclonal antibody,clone OTI2H3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

AZGP1 mouse monoclonal antibody,clone OTI10F2, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

AZGP1 mouse monoclonal antibody,clone OTI10F2, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

AZGP1 mouse monoclonal antibody,clone OTI2H3, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

AZGP1 mouse monoclonal antibody,clone OTI2H3, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP