Antibodies

View as table Download

Rabbit Polyclonal antibody to NR0B2 (nuclear receptor subfamily 0, group B, member 2)

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 64 and 257 of NR0B2 (Uniprot ID#Q15466)

Rabbit anti-NR0B2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR0B2

Rabbit Polyclonal Anti-NR0B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the N terminal of human NR0B2. Synthetic peptide located within the following region: STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA

Rabbit Polyclonal Anti-NR0B2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the middle region of human NR0B2. Synthetic peptide located within the following region: AEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSL

Rabbit Polyclonal Anti-NR0B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the middle region of human NR0B2. Synthetic peptide located within the following region: VQWLQCCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEA

Rabbit Polyclonal Anti-NR0B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the C terminal of human NR0B2. Synthetic peptide located within the following region: LQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSL

Rabbit Polyclonal Anti-NR0B2 Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR0B2 / SHP antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR0B2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Hamster, Rabbit (100%); Rat, Bovine, Bat (94%); Elephant, Panda, Horse, Pig, Opossum (88%); Dog (81%).

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI5F10 (formerly 5F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications WB
Reactivities Human
Conjugation Unconjugated

NR0B2 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR0B2

NR0B2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR0B2

NR0B2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-257 of human NR0B2 (NP_068804.1).
Modifications Unmodified

NR0B2 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)

Applications WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NR0B2 mouse monoclonal antibody, clone OTI6D8 (formerly 6D8)

Applications WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI5F10 (formerly 5F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI5F10 (formerly 5F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications WB
Reactivities Human
Conjugation Unconjugated

NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NR0B2 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications WB
Reactivities Human
Conjugation Unconjugated