PRF1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRF1 |
PRF1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRF1 |
Rabbit Polyclonal Anti-PRF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR |
Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222) |
Carrier-free (BSA/glycerol-free) Perforin-1 mouse monoclonal antibody, clone OTI3D7
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Perforin-1 mouse monoclonal antibody, clone OTI10A2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Perforin Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Perforin Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Perforin Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the C-terminal region of human PRF1. AA range:451-500 |
Perforin-1 mouse monoclonal antibody, clone OTI3D7
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
Perforin-1 mouse monoclonal antibody, clone OTI3D7, Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
Perforin-1 mouse monoclonal antibody, clone OTI3D7, HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
Perforin-1 mouse monoclonal antibody, clone OTI3D7
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Perforin-1 mouse monoclonal antibody, clone OTI10A2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
Perforin-1 mouse monoclonal antibody, clone OTI10A2, Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
Perforin-1 mouse monoclonal antibody, clone OTI10A2, HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
Perforin-1 mouse monoclonal antibody, clone OTI10A2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |