UHRF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UHRF2 |
UHRF2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UHRF2 |
Rabbit Polyclonal Anti-UHRF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the N terminal of human UHRF2. Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART |
UHRF2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UHRF2 |
Rabbit Polyclonal NIRF Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-UHRF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the middle region of human UHRF2. Synthetic peptide located within the following region: NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYK |
Carrier-free (BSA/glycerol-free) UHRF2 mouse monoclonal antibody,clone OTI4E10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UHRF2 mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UHRF2 mouse monoclonal antibody,clone OTI4G10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UHRF2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UHRF2 |
UHRF2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 441-622 of human UHRF2 (NP_690856.1). |
Modifications | Unmodified |
UHRF2 mouse monoclonal antibody,clone OTI4E10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
UHRF2 mouse monoclonal antibody,clone OTI4E10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
UHRF2 mouse monoclonal antibody,clone OTI4E10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UHRF2 mouse monoclonal antibody,clone OTI4E10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UHRF2 mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
UHRF2 mouse monoclonal antibody,clone OTI1H2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
UHRF2 mouse monoclonal antibody,clone OTI1H2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UHRF2 mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
UHRF2 mouse monoclonal antibody,clone OTI4G10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
UHRF2 mouse monoclonal antibody,clone OTI4G10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
UHRF2 mouse monoclonal antibody,clone OTI4G10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
UHRF2 mouse monoclonal antibody,clone OTI4G10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |