Rabbit Polyclonal Anti-AGER Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT |
Rabbit anti-AGER Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AGER |
Rabbit polyclonal AGER Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AGER antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human AGER. |
AGER Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 41-340 of human AGER (NP_001127.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
