RAGE (AGER) Rabbit Polyclonal Antibody

CAT#: TA346072

Rabbit Polyclonal Anti-AGER Antibody

Product Images

WB Suggested Anti-AGER Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

• 

  Lanes: Lane 1: 10ug of hRAGE HEK-293 lysateLane 2: 10ug of mRAGE HEK-293 lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 2500; Gene Name: AGER; Submitted by: Barry Hudson

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: advanced glycosylation end product-specific receptor
• Database Link:
  NP_751947
  Entrez Gene 11596 MouseEntrez Gene 177 Human
  UniProt ID Q15109
• Background: AGER mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. It is receptor for amyloid beta peptide.
• Synonyms: RAGE
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Dog: 92%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane