Antibodies

View as table Download

Rabbit Polyclonal Anti-DNAAF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNAAF1antibody: synthetic peptide directed towards the N terminal of human LRRC50. Synthetic peptide located within the following region: LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF

Rabbit Polyclonal Anti-DNAAF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNAAF1antibody: synthetic peptide directed towards the N terminal of human LRRC50. Synthetic peptide located within the following region: TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTL

Carrier-free (BSA/glycerol-free) LRRC50 mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRC50 mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRC50 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRC50 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRC50 mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRC50 mouse monoclonal antibody, clone OTI5F8 (formerly 5F8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRC50 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRC50 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

DNAAF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 516-725 of human DNAAF1 (NP_848547.4).
Modifications Unmodified

LRRC50 mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

LRRC50 mouse monoclonal antibody, clone OTI4E4 (formerly 4E4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LRRC50 mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LRRC50 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

LRRC50 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LRRC50 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

LRRC50 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LRRC50 mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications WB
Reactivities Human
Conjugation Unconjugated

LRRC50 mouse monoclonal antibody, clone OTI5F8 (formerly 5F8)

Applications WB
Reactivities Human
Conjugation Unconjugated

LRRC50 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications WB
Reactivities Human
Conjugation Unconjugated

LRRC50 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

LRRC50 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".