Rabbit polyclonal GLS Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS. |
Rabbit Polyclonal Anti-GLS Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT |
Glutaminase (GLS) Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 610-669 of human Glutaminase (Glutaminase (GLS)) (NP_055720.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
