Rabbit polyclonal PITX2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PITX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-151 amino acids from the C-terminal region of human PITX2. |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASS |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX2 antibody: synthetic peptide directed towards the N terminal of human PITX2. Synthetic peptide located within the following region: EFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQ |
Carrier-free (BSA/glycerol-free) PITX2 mouse monoclonal antibody,clone OTI1H10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PITX2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PITX2 |
PITX2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PITX2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PITX2 |
PITX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-324 of human PITX2 (NP_000316.2). |
| Modifications | Unmodified |
PITX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PITX2 (NP_000316.2). |
| Modifications | Unmodified |
PITX2 mouse monoclonal antibody,clone OTI1H10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PITX2 mouse monoclonal antibody,clone OTI1H10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PITX2 mouse monoclonal antibody,clone OTI1H10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PITX2 mouse monoclonal antibody,clone OTI1H10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
