Rabbit Polyclonal Anti-Rasa1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rasa1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT |
RASA1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 965-993 amino acids from the C-terminal region of Human RASA1 / RasGAP. |
Carrier-free (BSA/glycerol-free) RASA1 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RASA1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RASA1 |
RASA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human RASA1 (NP_002881.1). |
| Modifications | Unmodified |
RASA1 (GAP ) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RASA1 (GAP ) mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RASA1 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RASA1 mouse monoclonal antibody,clone 1A4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RASA1 mouse monoclonal antibody,clone 1A4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RASA1 mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RASA1 (GAP ) mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
