RBBP7 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2D8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
RBBP7 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2D8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
RBBP7 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4C9
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
RbAp46 (RBBP7) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human RBBP7 |
RbAp46 (RBBP7) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 190-219 amino acids from the Central region of Human RBBP7. |
Rabbit polyclonal Anti-RBBP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBBP7 antibody: synthetic peptide directed towards the N terminal of human RBBP7. Synthetic peptide located within the following region: MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH |
Rabbit polyclonal Anti-RBBP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBBP7 antibody: synthetic peptide directed towards the middle region of human RBBP7. Synthetic peptide located within the following region: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH |
Carrier-free (BSA/glycerol-free) RBBP7 mouse monoclonal antibody, clone OTI5A4 (formerly 5A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBBP7 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBBP7 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBBP7 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 Rabbit polyclonal Antibody
Applications | ChIP, IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RBBP7 (NP_002884.1). |
Modifications | Unmodified |
RBBP7 Rabbit polyclonal Antibody
Applications | ChIP, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RBBP7 (NP_002884.1). |
Modifications | Unmodified |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI5A4 (formerly 5A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI5A4 (formerly 5A4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI5A4 (formerly 5A4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI5A4 (formerly 5A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
RBBP7 mouse monoclonal antibody,clone 3A12, Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
RBBP7 mouse monoclonal antibody,clone 3A12, HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 399.00
3 Weeks
RBBP7 biotinylated detection antibody, Luminex validated mouse monoclonal antibody, clone OTI4C9
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600050 |