Rabbit Polyclonal Anti-TNFRSF18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV |
Rabbit Polyclonal Anti-TNFRSF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV |
Carrier-free (glycerol/BSA-free) TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-GITR (Clone YGITR 860.103.5)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-GITR (Clone DTA-1)
| Applications | FC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-GITR (Clone DTA-1)
| Applications | FC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This reformatted antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
