Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal WIPI2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal WIPI2 antibody was raised against a 17 amino acid peptide near the amino terminus of human WIPI2. |
WIPI2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 422~451 amino acids from the C-terminal region of human WIPI2 |
Rabbit Polyclonal Anti-WIPI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-WIPI2 Antibody is: synthetic peptide directed towards the C-terminal region of Human WIPI2. Synthetic peptide located within the following region: AFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLMASTS |
Mouse monoclonal Anti-WIPI2 Clone 2A2
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
WIPI2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human WIPI2 |
WIPI2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human WIPI2 |
Active filters
Category
- Antibodies
Target Symbol
- WIPI2