Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 11 of 11 results

(reset)

DNMT1 Rabbit Monoclonal Antibody [Clone ID: EPR3521(2)]

TA307586

USD 516.00

In Stock

Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

DNMT3A Mouse Monoclonal Antibody [Clone ID: 64B1446]

TA336580

USD 512.00

5 Days

Mouse Monoclonal DNMT3A Antibody (64B1446)

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

S adenosylhomocysteine hydrolase (AHCY) Rabbit Polyclonal Antibody

TA332593

USD 275.00

In Stock

Rabbit anti-AHCY Polyclonal Antibody

Applications	ICC/IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human AHCY

DNMT3A Rabbit Polyclonal Antibody

TA346818

USD 475.00

5 Days

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE

BHMT (391-402) Goat Polyclonal Antibody

AP22552PU-N

USD 440.00

2 Weeks

BHMT (391-402) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Hamster, Human, Monkey, Rat
Immunogen	Synthetic peptide from C-term of human BHMT

1 / 3

2 / 3

3 / 3

Previous Next

CBS Rabbit Polyclonal Antibody

TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2B11]

TA500531

USD 379.00

In Stock

LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2B11]

TA500531S

USD 159.00

2 Days

LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

TA503099

USD 379.00

In Stock

SMS (Spermine synthase) mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

TA503099S

USD 159.00

In Stock

SMS (Spermine synthase) mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SDS Mouse Monoclonal Antibody [Clone ID: OTI3D3]

TA503943

USD 379.00

In Stock

SDS mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

1 - 11 of 11 results