CCL5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCL5 |
CCL5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCL5 |
Rabbit anti-CCL5 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCL5 |
Anti-Murine RANTES Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine RANTES (CCL5) |
Anti-Human RANTES Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human RANTES (CCL5) |
Rabbit Polyclonal Anti-CCL5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
Biotinylated Anti-Human RANTES Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human RANTES (CCL5) |
Biotinylated Anti-Murine RANTES Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine RANTES (CCL5) |
CCL5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCL5 |