RANTES (CCL5) Rabbit Polyclonal Antibody

CAT#: TA342306

Rabbit Polyclonal Anti-CCL5 Antibody

Product Images

WB Suggested Anti-CCL5 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 10 kDa
• Gene Name: C-C motif chemokine ligand 5
• Database Link:
  NP_002976
  Entrez Gene 20304 Mouse
  UniProt ID P13501
• Background: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils.
• Synonyms: D17S136E; eoCP; RANTES; SCYA5; SIS-delta; SISd; TCP228
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 91%; Pig: 91%; Horse: 85%; Human: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway, Prion diseases, Toll-like receptor signaling pathway