ULK1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ULK1 |
ULK1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ULK1 |
Rabbit polyclonal APG1 (ULK1) Antibody (Center)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1). |
Rabbit Polyclonal ULK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ULK1 antibody was raised against a 16 amino acid peptide near the center of human ULK1 . |
Rabbit Polyclonal ULK1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids between 320 and 370 of human ULK1 was used as the immunogen, GenBank no. sp O75385.2 ULK1_HUMAN. |
Rabbit Polyclonal Anti-ULK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL |
ULK1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ULK1 |
ULK1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 400-499 of human ULK1 (NP_003556.1). |
Modifications | Unmodified |
Phospho-ULK1-S757 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S757 of human Phospho-ULK1-S757 (NP_003556.1). |
Modifications | Phospho S757 |
Phospho-ULK1-S555 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S555 of human Phospho-ULK1-S555 (NP_003556.1). |
Modifications | Phospho S555 |
Phospho-ULK1-S638 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S638 of human Phospho-ULK1-S638. |
Modifications | Phospho S638 |
Phospho-ULK1-S467 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S467 of human ULK1 |
Modifications | Phospho S467 |
ULK1/ULK2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ULK1/ULK2. |
ULK1 (phospho-Ser555) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic phosphopeptide derived from human ULK1 around the phosphorylation site of Ser555. |