Antibodies

View as table Download

ADRBK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADRBK1

Rabbit polyclonal ARBK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARBK1.

Rabbit polyclonal GRK2 (Ab-86) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ADRBK1.

Goat Polyclonal Antibody against ADRBK1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDAYREAQQLVQR, from the internal region of the protein sequence according to NP_001610.1.

Rabbit Polyclonal Anti-ADRBK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRBK1 antibody: synthetic peptide directed towards the N terminal of human ADRBK1. Synthetic peptide located within the following region: PEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEARPLVE

Rabbit Polyclonal Anti-ADRBK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRBK1 antibody: synthetic peptide directed towards the C terminal of human ADRBK1. Synthetic peptide located within the following region: ILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPL

Anti-ADRBK1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 644-659 amino acids of Human adrenergic, beta, receptor kinase 1