Antibodies

View as table Download

Rabbit Polyclonal Anti-PFN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL

PFN1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human PFN1

Rabbit Polyclonal Profilin 1 Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human protein (within residues 100-140). [Swiss-Prot# P07737]

Anti-PFN1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1

Anti-PFN1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1

Rabbit Polyclonal Anti-PFN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFN1

PFN1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFN1

Profilin 1 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Profilin1