Rabbit Polyclonal Anti-POLA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLA2 antibody is: synthetic peptide directed towards the N-terminal region of Human POLA2. Synthetic peptide located within the following region: VGLTSEILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEE |
Rabbit Polyclonal Anti-Pola2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pola2 antibody is: synthetic peptide directed towards the middle region of MOUSE Pola2. Synthetic peptide located within the following region: FSPSATPSQKYTSRTNRGEVVTTFGSAQGLSWSGRGGSGSVSLKVVGDPE |
POLA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human POLA2 (NP_002680.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China