Rabbit Polyclonal EF2C1/2 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EF2C1/2 antibody: human IEF2C1/2 (eukaryotic translation initiation factor 2C1 and 2), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of both EIF2C1 and EIF2C2. |
AGO1 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human AGO1 |
Goat Anti-EIF2C1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KNASYNLDPYIQEF, from the internal region of the protein sequence according to NP_036331.1. |
Rabbit Polyclonal Anti-AGO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGO1 antibody: synthetic peptide directed towards the N terminal of human AGO1. Synthetic peptide located within the following region: MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI |
Germany
Japan
United Kingdom
China
