Antibodies

Jump to Filters
View as table Download
ETFA (C-term) Rabbit Polyclonal Antibody
AP51468PU-N

USD 450.00

2 Weeks

ETFA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 283-311 amino acids from the C-terminal region of human ETFA
ETFA (C-term) Goat Polyclonal Antibody
AP21285PU-N

USD 375.00

5 Days

ETFA (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the C Terminus of the protein sequence according to NP_000117.1 and NP_001121188.1.
ETFA Goat Polyclonal Antibody
TA311118

USD 375.00

5 Days

Goat Anti-ETFA (aa139-152) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KSPDTFVRTIYAGN, from the internal region of the protein sequence according to NP_000117.1; NP_001121188.1.
ETFA Rabbit Polyclonal Antibody
TA336248

USD 375.00

5 Days

Rabbit Polyclonal Anti-ETFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETFA Antibody: synthetic peptide directed towards the N terminal of human ETFA. Synthetic peptide located within the following region: FRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEV
ETFA Rabbit Polyclonal Antibody
TA336249

USD 375.00

5 Days

Rabbit Polyclonal Anti-ETFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETFA Antibody: synthetic peptide directed towards the middle region of human ETFA. Synthetic peptide located within the following region: VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG