Antibodies

Jump to Filters
View as table Download
C1R Rabbit Polyclonal Antibody
AP31757PU-N

USD 440.00

2 Weeks

C1R rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from Human C1R.
Epitope: Amino Acids 445-494.
C2 Rabbit Polyclonal Antibody
TA346156

USD 410.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ
C1S Rabbit Polyclonal Antibody
TA311911

USD 345.00

In Stock

Rabbit polyclonal anti-C1S antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C1S.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
C2 Rabbit Polyclonal Antibody
TA346155

USD 475.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Cathepsin G (CTSG) Rabbit Polyclonal Antibody
TA347901

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Cathepsin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G
C2 Rabbit Polyclonal Antibody
TA308854

USD 415.00

5 Days

Rabbit Polyclonal antibody to Complement C2 (complement component 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681)
C1R Rabbit Polyclonal Antibody
TA311909

USD 345.00

In Stock

Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R heavy chain.
C1R Rabbit Polyclonal Antibody
TA311910

USD 345.00

In Stock

Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R.
C1S Rabbit Polyclonal Antibody
TA311912

USD 345.00

In Stock

Rabbit polyclonal C1S (heavy chain, Cleaved-Arg437) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1S.
C1S Goat Polyclonal Antibody
AP22474PU-N

USD 440.00

2 Weeks

C1S goat polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Complement component 1 subunit (C1s) purified from human plasma
Cathepsin G (CTSG) Rabbit Polyclonal Antibody
TA313710

USD 345.00

4 Weeks

Rabbit polyclonal CATG (Cleaved-Ile21) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CATG.
C1R Rabbit Polyclonal Antibody
TA342834

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ
Cathepsin G (CTSG) Rabbit Polyclonal Antibody
TA321410

USD 345.00

In Stock

Anti-CTSG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-255 amino acids of human cathepsin G