Antibodies

View as table Download

Rabbit Polyclonal Anti-ABL1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ABL1

c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

c Abl (ABL1) pTyr393/439 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from human ABL1/2 around the phosphorylation site of Tyrosine 393/439.

Goat Polyclonal Antibody against FYN

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence VQCKDKEATKLTE, from the N Terminus of the protein sequence according to NP_002028.1; NP_694592.1; NP_694593.1.

Rabbit polyclonal anti-ABL1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABL1.

Rabbit polyclonal ABL1 (Thr735) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ABL1 around the phosphorylation site of threonine 735 (S-V-TP-L-P).
Modifications Phospho-specific

Anti-ABL1/ABL2 (phospho-Tyr393/429) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 393/429 (D-T-Y(p)-T-A) derived from Human ABL1/2.
Modifications Phospho-specific

Rabbit polyclonal FYN Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FYN.

Rabbit Polyclonal c-Abl Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Abl

Rabbit Polyclonal Abl (Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal Abl (Tyr393/412) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 393/412
Modifications Phospho-specific

Rabbit Polyclonal Abl (Tyr412) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 412
Modifications Phospho-specific

Rabbit Polyclonal c-Abl (Tyr245) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Abl around the phosphorylation site of Tyrosine 245
Modifications Phospho-specific

Rabbit Polyclonal Fyn Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn

Rabbit Polyclonal Fyn (Tyr530) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn around the phosphorylation site of Tyrosine 530
Modifications Phospho-specific

Rabbit polyclonal Fyn (Phospho-Tyr530) antibody

Applications IHC, WB
Reactivities Human: Tyr530, Mouse: Tyr527
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).
Modifications Phospho-specific

Rabbit polyclonal Fyn (Ab-530) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).

c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

c Abl (ABL1) pTyr412 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Abl Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Abl

Rabbit Polyclonal c-Abl Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human c Abl (within residues 700-800). [Swiss-Prot# P00519]

c Abl (ABL1) pTyr204 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

FYN pTyr530 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

FYN rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse

Rabbit Polyclonal c-Abl Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Abl

Rabbit polyclonal Anti-FYN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FYN antibody: synthetic peptide directed towards the N terminal of human FYN. Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Rabbit polyclonal Anti-FYN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FYN antibody: synthetic peptide directed towards the middle region of human FYN. Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN

Anti-ABL2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of human v-abl Abelson murine leukemia viral oncogene homolog 2

Rabbit Polyclonal Anti-KYNU Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FYN