Antibodies

View as table Download

Rabbit anti-CLU Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLU

Clusterin (CLU) (488-501) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic peptide from the C-terminus of human CLU/Clusterin (NP_001822.2; NP_976084.1).

Clusterin (CLU) (Alpha) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Polyclonal Antibody against CLU

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKALQEYRKKHREE, from the C Terminus of the protein sequence according to NP_001822.2; NP_976084.1.

Clusterin (CLU) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 71-99 amino acids from the N-terminal region of human CLU

Rabbit Polyclonal Clusterin Antibody

Applications IHC, WB
Reactivities Human
Immunogen Clusterin antibody was raised recombinant human Clusterin isoform 1.

Anti-CLU Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 230 amino acids of human clusterin

Rabbit Polyclonal Anti-CLU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN

Rabbit Polyclonal Anti-CLU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLU