Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human, Rat |
Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human, Rat |
Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Rabbit Polyclonal Anti-NPY Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP |
Neuropeptide Y (NPY) (31-36) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Porcine |
Immunogen | Synthetic Porcine Neuropeptide Y coupled to bovine thyroglobulin via glutaraldehyde |
Neuropeptide Y (NPY) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human, Rat |
Immunogen | Synthetic peptide corresponding to the C-flanking peptide (amino acids 68-97) of Neuropeptide Y. |
Neuropeptide Y (NPY) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish |
Conjugation | Unconjugated |
Neuropeptide Y (NPY) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Neuropeptide Y (NPY) guinea pig polyclonal antibody
Applications | IHC |
Reactivities | Rat |
Conjugation | Unconjugated |
Anti-NPY Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |