Antibodies

Jump to Filters
View as table Download
Noelin (OLFM1) Rabbit Polyclonal Antibody
TA322511

USD 345.00

In Stock

Anti-OLFM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-220 amino acids of human olfactomedin 1
Noelin (OLFM1) Rabbit Polyclonal Antibody
TA331216

USD 375.00

5 Days

Rabbit Polyclonal Anti-OLFM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the N-terminal region of Human OLFM1. Synthetic peptide located within the following region: VLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK
Noelin (OLFM1) Rabbit Polyclonal Antibody
TA331217

USD 375.00

5 Days

Rabbit Polyclonal Anti-OLFM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the C-terminal region of Human OLFM1. Synthetic peptide located within the following region: EKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLA
Noelin (OLFM1) Rabbit Polyclonal Antibody
TA349568

USD 345.00

In Stock

Rabbit Polyclonal Anti-OLFM1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OLFM1
Noelin (OLFM1) Rabbit Polyclonal Antibody
TA379458

USD 220.00

3 Weeks

OLFM1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human OLFM1 (NP_055094.1).
Modifications Unmodified