MIWI Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of mouse MIWI |
MIWI Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of mouse MIWI |
Rabbit Polyclonal Anti-PIWIL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the N terminal of human PIWIL1. Synthetic peptide located within the following region: FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR |
Rabbit Polyclonal Anti-PIWIL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the middle region of human PIWIL1. Synthetic peptide located within the following region: LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY |
Rabbit Polyclonal PIWI-L1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIWI-L1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human PIWI-L1. |
Rabbit anti-PIWIL1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | peptide from the intermediate residues of human PIWIL1 protein. |
Anti-PIWIL1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 555-847 amino acids of human piwi-like RNA-mediated gene silencing 1 |
Anti-PIWIL1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 555-847 amino acids of human piwi-like RNA-mediated gene silencing 1 |
MIWI Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of mouse PIWIL1 |
Modifications | Unmodified |