Rabbit Polyclonal EndoG Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | EndoG antibody was raised with a synthetic peptide corresponding to 15 amino acids near the amino terminus of human EndoG. The immunogen is located within amino acids 40 - 90 of EndoG. |
Endo G (ENDOG) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ENDOG |
Endo G (ENDOG) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 280 of rat EndoG |
Rabbit Polyclonal Anti-ENDOG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENDOG antibody: synthetic peptide directed towards the middle region of human ENDOG. Synthetic peptide located within the following region: YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS |
Germany
Japan
United Kingdom
China
