Antibodies

View as table Download

LOC102723996 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 216-246 amino acids from the C-terminal region of human CD275 / ICOS Ligand

Rabbit Polyclonal Anti-ICOSLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV

Anti-ICOSLG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 70-84 amino acids of human inducible T-cell co-stimulator ligand

Rabbit Polyclonal Anti-ICOSLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ICOSLG