Antibodies

Jump to Filters
View as table Download
GSTA2 Rabbit Polyclonal Antibody
TA308025

USD 415.00

5 Days

Rabbit Polyclonal antibody to GSTA2 (glutathione S-transferase alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 196 of GSTA2 (Uniprot ID#P09210)
CYP1B1 Rabbit Polyclonal Antibody
TA590005

USD 409.00

In Stock

Rabbit Polyclonal CYP1B1 Antibody

Applications ELISA, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
AKR1C1 Rabbit Polyclonal Antibody
TA342867

USD 375.00

5 Days

Rabbit Polyclonal Anti-AKR1C1 Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL