AKR1C1 Rabbit Polyclonal Antibody

CAT#: TA342867

Rabbit Polyclonal Anti-AKR1C1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "AKR1C1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Monkey
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name aldo-keto reductase family 1, member C1
Background This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Synonyms 2-ALPHA-HSD; 20-ALPHA-HSD; C9; DD1; DD2; DDH; DDH1; H-37; HAKRC; HBAB; MBAB
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Horse: 86%; Sheep: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Metabolism of xenobiotics by cytochrome P450

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.