Germany
Japan
United Kingdom
China
AKR1C1 (1-323) mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
Antibodies
View as table Download
AKR1C1 (1-323) mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal antibody to AKR1C1 (aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 22 and 248 of AKR1C1 (Uniprot ID#Q04828) |
Rabbit Polyclonal Anti-AKR1C1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: LERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATW |
Rabbit Polyclonal Anti-AKR1C1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL |
Anti-AKR1C1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 290-304 amino acids of human aldo-keto reductase family 1, member C1 |
AKR1C1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AKR1C1 |
AKR1C1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human AK1C1 |
AKR1C1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C1 (NP_001344.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- AKR1C1