DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3. |
DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3. |
Rabbit Polyclonal DLL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody. |
Rabbit Polyclonal Anti-DLL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL |
Rabbit Polyclonal Anti-DLL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC |